CUTL1 monoclonal antibody (M02), clone 2D10
  • CUTL1 monoclonal antibody (M02), clone 2D10

CUTL1 monoclonal antibody (M02), clone 2D10

Ref: AB-H00001523-M02
CUTL1 monoclonal antibody (M02), clone 2D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CUTL1.
Información adicional
Size 100 ug
Gene Name CUX1
Gene Alias CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Gene Description cut-like homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CUTL1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1523
Clone Number 2D10
Iso type IgG1 Kappa

Enviar un mensaje


CUTL1 monoclonal antibody (M02), clone 2D10

CUTL1 monoclonal antibody (M02), clone 2D10