CUX1 monoclonal antibody (M01J), clone 2A10
  • CUX1 monoclonal antibody (M01J), clone 2A10

CUX1 monoclonal antibody (M01J), clone 2A10

Ref: AB-H00001523-M01J
CUX1 monoclonal antibody (M01J), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CUX1.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 100 ug
Gene Name CUX1
Gene Alias CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Gene Description cut-like homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CUX1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1523
Clone Number 2A10
Iso type IgG1 Kappa

Enviar un mensaje


CUX1 monoclonal antibody (M01J), clone 2A10

CUX1 monoclonal antibody (M01J), clone 2A10