CUTL1 polyclonal antibody (A01)
  • CUTL1 polyclonal antibody (A01)

CUTL1 polyclonal antibody (A01)

Ref: AB-H00001523-A01
CUTL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CUTL1.
Información adicional
Size 50 uL
Gene Name CUX1
Gene Alias CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75
Gene Description cut-like homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CUTL1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1523

Enviar un mensaje


CUTL1 polyclonal antibody (A01)

CUTL1 polyclonal antibody (A01)