CTSW monoclonal antibody (M01), clone 4A8
  • CTSW monoclonal antibody (M01), clone 4A8

CTSW monoclonal antibody (M01), clone 4A8

Ref: AB-H00001521-M01
CTSW monoclonal antibody (M01), clone 4A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CTSW.
Información adicional
Size 100 ug
Gene Name CTSW
Gene Alias LYPN
Gene Description cathepsin W
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTSW (AAH48255, 22 a.a. ~ 376 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1521
Clone Number 4A8
Iso type IgG2a Kappa

Enviar un mensaje


CTSW monoclonal antibody (M01), clone 4A8

CTSW monoclonal antibody (M01), clone 4A8