CTSS purified MaxPab rabbit polyclonal antibody (D01P)
  • CTSS purified MaxPab rabbit polyclonal antibody (D01P)

CTSS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001520-D01P
CTSS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTSS protein.
Información adicional
Size 100 ug
Gene Name CTSS
Gene Alias MGC3886
Gene Description cathepsin S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDAR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTSS (NP_004070.3, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1520

Enviar un mensaje


CTSS purified MaxPab rabbit polyclonal antibody (D01P)

CTSS purified MaxPab rabbit polyclonal antibody (D01P)