CTSH monoclonal antibody (M01A), clone 3D10
  • CTSH monoclonal antibody (M01A), clone 3D10

CTSH monoclonal antibody (M01A), clone 3D10

Ref: AB-H00001512-M01A
CTSH monoclonal antibody (M01A), clone 3D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTSH.
Información adicional
Size 200 uL
Gene Name CTSH
Gene Alias ACC-4|ACC-5|CPSB|DKFZp686B24257|MGC1519|minichain
Gene Description cathepsin H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTSH (NP_004381.2, 157 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1512
Clone Number 3D10
Iso type IgM Kappa

Enviar un mensaje


CTSH monoclonal antibody (M01A), clone 3D10

CTSH monoclonal antibody (M01A), clone 3D10