CTSD MaxPab rabbit polyclonal antibody (D01)
  • CTSD MaxPab rabbit polyclonal antibody (D01)

CTSD MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001509-D01
CTSD MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTSD protein.
Información adicional
Size 100 uL
Gene Name CTSD
Gene Alias CLN10|CPSD|MGC2311
Gene Description cathepsin D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTSD (AAH16320.1, 1 a.a. ~ 412 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1509

Enviar un mensaje


CTSD MaxPab rabbit polyclonal antibody (D01)

CTSD MaxPab rabbit polyclonal antibody (D01)