CTRB1 monoclonal antibody (M02), clone 3C8
  • CTRB1 monoclonal antibody (M02), clone 3C8

CTRB1 monoclonal antibody (M02), clone 3C8

Ref: AB-H00001504-M02
CTRB1 monoclonal antibody (M02), clone 3C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTRB1.
Información adicional
Size 100 ug
Gene Name CTRB1
Gene Alias CTRB|FLJ42412|MGC88037
Gene Description chymotrypsinogen B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTRB1 (NP_001897, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1504
Clone Number 3C8
Iso type IgG2a Kappa

Enviar un mensaje


CTRB1 monoclonal antibody (M02), clone 3C8

CTRB1 monoclonal antibody (M02), clone 3C8