CTLA4 monoclonal antibody (M06), clone 2F1
  • CTLA4 monoclonal antibody (M06), clone 2F1

CTLA4 monoclonal antibody (M06), clone 2F1

Ref: AB-H00001493-M06
CTLA4 monoclonal antibody (M06), clone 2F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CTLA4.
Información adicional
Size 100 ug
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTLA4 (NP_005205, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1493
Clone Number 2F1
Iso type IgG2a Kappa

Enviar un mensaje


CTLA4 monoclonal antibody (M06), clone 2F1

CTLA4 monoclonal antibody (M06), clone 2F1