CTF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CTF1 purified MaxPab rabbit polyclonal antibody (D01P)

CTF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001489-D01P
CTF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTF1 protein.
Información adicional
Size 100 ug
Gene Name CTF1
Gene Alias CT-1|CT1
Gene Description cardiotrophin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTF1 (NP_001321.1, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1489

Enviar un mensaje


CTF1 purified MaxPab rabbit polyclonal antibody (D01P)

CTF1 purified MaxPab rabbit polyclonal antibody (D01P)