CTBP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CTBP2 purified MaxPab rabbit polyclonal antibody (D01P)

CTBP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001488-D01P
CTBP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTBP2 protein.
Información adicional
Size 100 ug
Gene Name CTBP2
Gene Alias -
Gene Description C-terminal binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRPGLPGPTGLCAQTSSRGQKSVLKQKESCGIWQLYHFLSRKQEPRWEPCVSGSSSGDGAVADLADELRGYPALCCTLPVHSYRSWAGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTBP2 (AAH37900.1, 1 a.a. ~ 513 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1488

Enviar un mensaje


CTBP2 purified MaxPab rabbit polyclonal antibody (D01P)

CTBP2 purified MaxPab rabbit polyclonal antibody (D01P)