NKX2-5 purified MaxPab rabbit polyclonal antibody (D01P)
  • NKX2-5 purified MaxPab rabbit polyclonal antibody (D01P)

NKX2-5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001482-D01P
NKX2-5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NKX2-5 protein.
Información adicional
Size 100 ug
Gene Name NKX2-5
Gene Alias CHNG5|CSX|CSX1|NKX2.5|NKX2E|NKX4-1
Gene Description NK2 transcription factor related, locus 5 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NKX2-5 (NP_004378.1, 1 a.a. ~ 324 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1482

Enviar un mensaje


NKX2-5 purified MaxPab rabbit polyclonal antibody (D01P)

NKX2-5 purified MaxPab rabbit polyclonal antibody (D01P)