NKX2-5 polyclonal antibody (A01)
  • NKX2-5 polyclonal antibody (A01)

NKX2-5 polyclonal antibody (A01)

Ref: AB-H00001482-A01
NKX2-5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NKX2-5.
Información adicional
Size 50 uL
Gene Name NKX2-5
Gene Alias CHNG5|CSX|CSX1|NKX2.5|NKX2E|NKX4-1
Gene Description NK2 transcription factor related, locus 5 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NKX2-5 (AAH25711, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1482

Enviar un mensaje


NKX2-5 polyclonal antibody (A01)

NKX2-5 polyclonal antibody (A01)