CSTF3 polyclonal antibody (A01)
  • CSTF3 polyclonal antibody (A01)

CSTF3 polyclonal antibody (A01)

Ref: AB-H00001479-A01
CSTF3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CSTF3.
Información adicional
Size 50 uL
Gene Name CSTF3
Gene Alias CSTF-77|MGC117398|MGC43001|MGC75122
Gene Description cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSTF3 (AAH09792, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1479

Enviar un mensaje


CSTF3 polyclonal antibody (A01)

CSTF3 polyclonal antibody (A01)