CST6 MaxPab mouse polyclonal antibody (B01P)
  • CST6 MaxPab mouse polyclonal antibody (B01P)

CST6 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001474-B01P
CST6 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CST6 protein.
Información adicional
Size 50 ug
Gene Name CST6
Gene Alias -
Gene Description cystatin E/M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARSNLPLALGLALVAFCLLALPRDARARPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CST6 (NP_001314.1, 1 a.a. ~ 149 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1474

Enviar un mensaje


CST6 MaxPab mouse polyclonal antibody (B01P)

CST6 MaxPab mouse polyclonal antibody (B01P)