CST5 purified MaxPab mouse polyclonal antibody (B01P)
  • CST5 purified MaxPab mouse polyclonal antibody (B01P)

CST5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001473-B01P
CST5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CST5 protein.
Información adicional
Size 50 ug
Gene Name CST5
Gene Alias MGC71922
Gene Description cystatin D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CST5 (NP_001891.2, 1 a.a. ~ 142 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1473

Enviar un mensaje


CST5 purified MaxPab mouse polyclonal antibody (B01P)

CST5 purified MaxPab mouse polyclonal antibody (B01P)