CST3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CST3 purified MaxPab rabbit polyclonal antibody (D01P)

CST3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001471-D01P
CST3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CST3 protein.
Información adicional
Size 100 ug
Gene Name CST3
Gene Alias ARMD11|MGC117328
Gene Description cystatin C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CST3 (NP_000090.1, 1 a.a. ~ 146 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1471

Enviar un mensaje


CST3 purified MaxPab rabbit polyclonal antibody (D01P)

CST3 purified MaxPab rabbit polyclonal antibody (D01P)