CSRP1 polyclonal antibody (A01)
  • CSRP1 polyclonal antibody (A01)

CSRP1 polyclonal antibody (A01)

Ref: AB-H00001465-A01
CSRP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CSRP1.
Información adicional
Size 50 uL
Gene Name CSRP1
Gene Alias CRP|CRP1|CSRP|CYRP|D1S181E|DKFZp686M148
Gene Description cysteine and glycine-rich protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSRP1 (NP_004069, 94 a.a. ~ 192 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1465

Enviar un mensaje


CSRP1 polyclonal antibody (A01)

CSRP1 polyclonal antibody (A01)