CSNK2A2 monoclonal antibody (M03), clone 1E8
  • CSNK2A2 monoclonal antibody (M03), clone 1E8

CSNK2A2 monoclonal antibody (M03), clone 1E8

Ref: AB-H00001459-M03
CSNK2A2 monoclonal antibody (M03), clone 1E8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CSNK2A2.
Información adicional
Size 100 ug
Gene Name CSNK2A2
Gene Alias CK2A2|CSNK2A1|FLJ43934
Gene Description casein kinase 2, alpha prime polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLID
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CSNK2A2 (NP_001887.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1459
Clone Number 1E8
Iso type IgG2a Kappa

Enviar un mensaje


CSNK2A2 monoclonal antibody (M03), clone 1E8

CSNK2A2 monoclonal antibody (M03), clone 1E8