CSNK2A2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CSNK2A2 purified MaxPab rabbit polyclonal antibody (D01P)

CSNK2A2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001459-D01P
CSNK2A2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CSNK2A2 protein.
Información adicional
Size 100 ug
Gene Name CSNK2A2
Gene Alias CK2A2|CSNK2A1|FLJ43934
Gene Description casein kinase 2, alpha prime polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSNK2A2 (NP_001887.1, 1 a.a. ~ 350 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1459

Enviar un mensaje


CSNK2A2 purified MaxPab rabbit polyclonal antibody (D01P)

CSNK2A2 purified MaxPab rabbit polyclonal antibody (D01P)