CSNK1G2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CSNK1G2 purified MaxPab rabbit polyclonal antibody (D01P)

CSNK1G2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001455-D01P
CSNK1G2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CSNK1G2 protein.
Información adicional
Size 100 ug
Gene Name CSNK1G2
Gene Alias CK1g2
Gene Description casein kinase 1, gamma 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGNYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSNK1G2 (NP_001310.2, 1 a.a. ~ 415 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1455

Enviar un mensaje


CSNK1G2 purified MaxPab rabbit polyclonal antibody (D01P)

CSNK1G2 purified MaxPab rabbit polyclonal antibody (D01P)