CSH1 MaxPab mouse polyclonal antibody (B01P)
  • CSH1 MaxPab mouse polyclonal antibody (B01P)

CSH1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001442-B01P
CSH1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CSH1 protein.
Información adicional
Size 50 ug
Gene Name CSH1
Gene Alias CSA|CSMT|FLJ75407|PL
Gene Description chorionic somatomammotropin hormone 1 (placental lactogen)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti
Immunogen Prot. Seq MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSH1 (NP_001308.1, 1 a.a. ~ 217 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1442

Enviar un mensaje


CSH1 MaxPab mouse polyclonal antibody (B01P)

CSH1 MaxPab mouse polyclonal antibody (B01P)