CSF2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CSF2 purified MaxPab rabbit polyclonal antibody (D01P)

CSF2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001437-D01P
CSF2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CSF2 protein.
Información adicional
Size 100 ug
Gene Name CSF2
Gene Alias GMCSF|MGC131935|MGC138897
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSF2 (AAI14000.1, 1 a.a. ~ 144 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1437

Enviar un mensaje


CSF2 purified MaxPab rabbit polyclonal antibody (D01P)

CSF2 purified MaxPab rabbit polyclonal antibody (D01P)