CSF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CSF1 purified MaxPab rabbit polyclonal antibody (D01P)

CSF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001435-D01P
CSF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CSF1 protein.
Información adicional
Size 100 ug
Gene Name CSF1
Gene Alias MCSF|MGC31930
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CSF1 (NP_000748.3, 1 a.a. ~ 554 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1435

Enviar un mensaje


CSF1 purified MaxPab rabbit polyclonal antibody (D01P)

CSF1 purified MaxPab rabbit polyclonal antibody (D01P)