Ver mas grande
CSE1L monoclonal antibody (M04A), clone 2F4
AB-H00001434-M04A
Producto nuevo
CSE1L monoclonal antibody (M04A), clone 2F4
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | CSE1L |
| Gene Alias | CAS|CSE1|MGC117283|MGC130036|MGC130037|XPO2 |
| Gene Description | CSE1 chromosome segregation 1-like (yeast) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 1434 |
| Clone Number | 2F4 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant CSE1L.