CRYM purified MaxPab rabbit polyclonal antibody (D01P)
  • CRYM purified MaxPab rabbit polyclonal antibody (D01P)

CRYM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001428-D01P
CRYM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CRYM protein.
Información adicional
Size 100 ug
Gene Name CRYM
Gene Alias DFNA40|THBP
Gene Description crystallin, mu
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRYM (NP_001879.1, 1 a.a. ~ 314 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1428

Enviar un mensaje


CRYM purified MaxPab rabbit polyclonal antibody (D01P)

CRYM purified MaxPab rabbit polyclonal antibody (D01P)