CRYGC monoclonal antibody (M01), clone 7C4
  • CRYGC monoclonal antibody (M01), clone 7C4

CRYGC monoclonal antibody (M01), clone 7C4

Ref: AB-H00001420-M01C
CRYGC monoclonal antibody (M01), clone 7C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRYGC.
This product is belong to Cell Culture Grade Antibody (CX Grade).
Información adicional
Size 200 uL
Gene Name CRYGC
Gene Alias CCL|CRYG3
Gene Description crystallin, gamma C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYGC (NP_066269, 75 a.a. ~ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In condensed culture supernatant
Gene ID 1420
Clone Number 7C4
Iso type IgG2a Kappa

Enviar un mensaje


CRYGC monoclonal antibody (M01), clone 7C4

CRYGC monoclonal antibody (M01), clone 7C4