CRYBA1 polyclonal antibody (A01)
  • CRYBA1 polyclonal antibody (A01)

CRYBA1 polyclonal antibody (A01)

Ref: AB-H00001411-A01
CRYBA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRYBA1.
Información adicional
Size 50 uL
Gene Name CRYBA1
Gene Alias CRYB1
Gene Description crystallin, beta A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ICSANHKESKMTIFEKENFIGRQWEISDDYPSLQAMGWFNNEVGSMKIQSGAWVCYQYPGYRGYQYILECDHHGGDYKHWREWGSHAQTSQIQSIRRIQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYBA1 (NP_005199, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1411

Enviar un mensaje


CRYBA1 polyclonal antibody (A01)

CRYBA1 polyclonal antibody (A01)