CRYAB monoclonal antibody (M02), clone 4E8-1C5
  • CRYAB monoclonal antibody (M02), clone 4E8-1C5

CRYAB monoclonal antibody (M02), clone 4E8-1C5

Ref: AB-H00001410-M02
CRYAB monoclonal antibody (M02), clone 4E8-1C5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CRYAB.
Información adicional
Size 100 ug
Gene Name CRYAB
Gene Alias CRYA2|CTPP2|HSPB5
Gene Description crystallin, alpha B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYAB (AAH07008, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1410
Clone Number 4E8-1C5
Iso type IgG1 Kappa

Enviar un mensaje


CRYAB monoclonal antibody (M02), clone 4E8-1C5

CRYAB monoclonal antibody (M02), clone 4E8-1C5