CRYAB monoclonal antibody (M01A), clone S4
  • CRYAB monoclonal antibody (M01A), clone S4

CRYAB monoclonal antibody (M01A), clone S4

Ref: AB-H00001410-M01A
CRYAB monoclonal antibody (M01A), clone S4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CRYAB.
Información adicional
Size 200 uL
Gene Name CRYAB
Gene Alias CRYA2|CTPP2|HSPB5
Gene Description crystallin, alpha B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce
Immunogen Prot. Seq MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYAB (AAH07008.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 1410
Clone Number S4
Iso type IgG1 Kappa

Enviar un mensaje


CRYAB monoclonal antibody (M01A), clone S4

CRYAB monoclonal antibody (M01A), clone S4