CRYAB monoclonal antibody (M01), clone 1A10-1A4
  • CRYAB monoclonal antibody (M01), clone 1A10-1A4

CRYAB monoclonal antibody (M01), clone 1A10-1A4

Ref: AB-H00001410-M01
CRYAB monoclonal antibody (M01), clone 1A10-1A4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CRYAB.
Información adicional
Size 100 ug
Gene Name CRYAB
Gene Alias CRYA2|CTPP2|HSPB5
Gene Description crystallin, alpha B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYAB (AAH07008, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1410
Clone Number 1A10-1A4
Iso type IgG1 kappa

Enviar un mensaje


CRYAB monoclonal antibody (M01), clone 1A10-1A4

CRYAB monoclonal antibody (M01), clone 1A10-1A4