CRYAB polyclonal antibody (A01)
  • CRYAB polyclonal antibody (A01)

CRYAB polyclonal antibody (A01)

Ref: AB-H00001410-A01
CRYAB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CRYAB.
Información adicional
Size 50 uL
Gene Name CRYAB
Gene Alias CRYA2|CTPP2|HSPB5
Gene Description crystallin, alpha B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRYAB (AAH07008, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1410

Enviar un mensaje


CRYAB polyclonal antibody (A01)

CRYAB polyclonal antibody (A01)