CRY2 monoclonal antibody (M03), clone 3H4
  • CRY2 monoclonal antibody (M03), clone 3H4

CRY2 monoclonal antibody (M03), clone 3H4

Ref: AB-H00001408-M03
CRY2 monoclonal antibody (M03), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRY2.
Información adicional
Size 100 ug
Gene Name CRY2
Gene Alias FLJ10332|HCRY2|KIAA0658|PHLL2
Gene Description cryptochrome 2 (photolyase-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRY2 (NP_066940.1, 141 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1408
Clone Number 3H4
Iso type IgG2a Kappa

Enviar un mensaje


CRY2 monoclonal antibody (M03), clone 3H4

CRY2 monoclonal antibody (M03), clone 3H4