HAPLN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HAPLN1 purified MaxPab rabbit polyclonal antibody (D01P)

HAPLN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001404-D01P
HAPLN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HAPLN1 protein.
Información adicional
Size 100 ug
Gene Name HAPLN1
Gene Alias CRTL1
Gene Description hyaluronan and proteoglycan link protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HAPLN1 (NP_001875.1, 1 a.a. ~ 354 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1404

Enviar un mensaje


HAPLN1 purified MaxPab rabbit polyclonal antibody (D01P)

HAPLN1 purified MaxPab rabbit polyclonal antibody (D01P)