CRKL polyclonal antibody (A01)
  • CRKL polyclonal antibody (A01)

CRKL polyclonal antibody (A01)

Ref: AB-H00001399-A01
CRKL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CRKL.
Información adicional
Size 50 uL
Gene Name CRKL
Gene Alias -
Gene Description v-crk sarcoma virus CT10 oncogene homolog (avian)-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRKL (NP_005198, 204 a.a. ~ 303 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1399

Enviar un mensaje


CRKL polyclonal antibody (A01)

CRKL polyclonal antibody (A01)