CREM monoclonal antibody (M02), clone 3B5
  • CREM monoclonal antibody (M02), clone 3B5

CREM monoclonal antibody (M02), clone 3B5

Ref: AB-H00001390-M02
CREM monoclonal antibody (M02), clone 3B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CREM.
Información adicional
Size 100 ug
Gene Name CREM
Gene Alias ICER|MGC111110|MGC17881|MGC41893|hCREM-2
Gene Description cAMP responsive element modulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1390
Clone Number 3B5
Iso type IgG1 Kappa

Enviar un mensaje


CREM monoclonal antibody (M02), clone 3B5

CREM monoclonal antibody (M02), clone 3B5