CREB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CREB1 purified MaxPab rabbit polyclonal antibody (D01P)

CREB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001385-D01P
CREB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CREB1 protein.
Información adicional
Size 100 ug
Gene Name CREB1
Gene Alias CREB|MGC9284
Gene Description cAMP responsive element binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CREB1 (NP_004370.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1385

Enviar un mensaje


CREB1 purified MaxPab rabbit polyclonal antibody (D01P)

CREB1 purified MaxPab rabbit polyclonal antibody (D01P)