CRABP2 monoclonal antibody (M01), clone 4F2
  • CRABP2 monoclonal antibody (M01), clone 4F2

CRABP2 monoclonal antibody (M01), clone 4F2

Ref: AB-H00001382-M01
CRABP2 monoclonal antibody (M01), clone 4F2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CRABP2.
Información adicional
Size 100 ug
Gene Name CRABP2
Gene Alias CRABP-II|RBP6
Gene Description cellular retinoic acid binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRABP2 (NP_001869.1, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1382
Clone Number 4F2
Iso type IgG2a Kappa

Enviar un mensaje


CRABP2 monoclonal antibody (M01), clone 4F2

CRABP2 monoclonal antibody (M01), clone 4F2