CRABP2 purified MaxPab mouse polyclonal antibody (B01P)
  • CRABP2 purified MaxPab mouse polyclonal antibody (B01P)

CRABP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001382-B01P
CRABP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CRABP2 protein.
Información adicional
Size 50 ug
Gene Name CRABP2
Gene Alias CRABP-II|RBP6
Gene Description cellular retinoic acid binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CRABP2 (NP_001869.1, 1 a.a. ~ 138 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1382

Enviar un mensaje


CRABP2 purified MaxPab mouse polyclonal antibody (B01P)

CRABP2 purified MaxPab mouse polyclonal antibody (B01P)