CPT2 purified MaxPab rabbit polyclonal antibody (D01P)
  • CPT2 purified MaxPab rabbit polyclonal antibody (D01P)

CPT2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001376-D01P
CPT2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CPT2 protein.
Información adicional
Size 100 ug
Gene Name CPT2
Gene Alias CPT1|CPTASE
Gene Description carnitine palmitoyltransferase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKARHLLVLRKGNFYIFD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CPT2 (AAH02445.1, 1 a.a. ~ 658 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1376

Enviar un mensaje


CPT2 purified MaxPab rabbit polyclonal antibody (D01P)

CPT2 purified MaxPab rabbit polyclonal antibody (D01P)