CPT2 polyclonal antibody (A01)
  • CPT2 polyclonal antibody (A01)

CPT2 polyclonal antibody (A01)

Ref: AB-H00001376-A01
CPT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CPT2.
Información adicional
Size 50 uL
Gene Name CPT2
Gene Alias CPT1|CPTASE
Gene Description carnitine palmitoyltransferase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPT2 (AAH05172, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1376

Enviar un mensaje


CPT2 polyclonal antibody (A01)

CPT2 polyclonal antibody (A01)