CPT1A monoclonal antibody (M02), clone 1D3
  • CPT1A monoclonal antibody (M02), clone 1D3

CPT1A monoclonal antibody (M02), clone 1D3

Ref: AB-H00001374-M02
CPT1A monoclonal antibody (M02), clone 1D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPT1A.
Información adicional
Size 100 ug
Gene Name CPT1A
Gene Alias CPT1|CPT1-L|L-CPT1
Gene Description carnitine palmitoyltransferase 1A (liver)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPT1A (NP_001867.2, 461 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1374
Clone Number 1D3
Iso type IgG2a Kappa

Enviar un mensaje


CPT1A monoclonal antibody (M02), clone 1D3

CPT1A monoclonal antibody (M02), clone 1D3