CPT1A purified MaxPab rabbit polyclonal antibody (D01P)
  • CPT1A purified MaxPab rabbit polyclonal antibody (D01P)

CPT1A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001374-D01P
CPT1A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CPT1A protein.
Información adicional
Size 100 ug
Gene Name CPT1A
Gene Alias CPT1|CPT1-L|L-CPT1
Gene Description carnitine palmitoyltransferase 1A (liver)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CPT1A (NP_001867.2, 1 a.a. ~ 773 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1374

Enviar un mensaje


CPT1A purified MaxPab rabbit polyclonal antibody (D01P)

CPT1A purified MaxPab rabbit polyclonal antibody (D01P)