CPS1 monoclonal antibody (M01), clone 8H8
  • CPS1 monoclonal antibody (M01), clone 8H8

CPS1 monoclonal antibody (M01), clone 8H8

Ref: AB-H00001373-M01
CPS1 monoclonal antibody (M01), clone 8H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CPS1.
Información adicional
Size 100 ug
Gene Name CPS1
Gene Alias -
Gene Description carbamoyl-phosphate synthetase 1, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1373
Clone Number 8H8
Iso type IgG1 Kappa

Enviar un mensaje


CPS1 monoclonal antibody (M01), clone 8H8

CPS1 monoclonal antibody (M01), clone 8H8