CPM polyclonal antibody (A01)
  • CPM polyclonal antibody (A01)

CPM polyclonal antibody (A01)

Ref: AB-H00001368-A01
CPM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CPM.
Información adicional
Size 50 uL
Gene Name CPM
Gene Alias -
Gene Description carboxypeptidase M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CPM (NP_001005502, 251 a.a. ~ 349 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1368

Enviar un mensaje


CPM polyclonal antibody (A01)

CPM polyclonal antibody (A01)