CLDN7 MaxPab rabbit polyclonal antibody (D01)
  • CLDN7 MaxPab rabbit polyclonal antibody (D01)

CLDN7 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00001366-D01
CLDN7 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CLDN7 protein.
Información adicional
Size 100 uL
Gene Name CLDN7
Gene Alias CEPTRL2|CPETRL2|Hs.84359|claudin-1
Gene Description claudin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CLDN7 (NP_001298.2, 1 a.a. ~ 211 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 1366

Enviar un mensaje


CLDN7 MaxPab rabbit polyclonal antibody (D01)

CLDN7 MaxPab rabbit polyclonal antibody (D01)