CPA1 purified MaxPab mouse polyclonal antibody (B01P)
  • CPA1 purified MaxPab mouse polyclonal antibody (B01P)

CPA1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00001357-B01P
CPA1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CPA1 protein.
Información adicional
Size 50 ug
Gene Name CPA1
Gene Alias CPA
Gene Description carboxypeptidase A1 (pancreatic)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CPA1 (NP_001859.1, 1 a.a. ~ 419 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1357

Enviar un mensaje


CPA1 purified MaxPab mouse polyclonal antibody (B01P)

CPA1 purified MaxPab mouse polyclonal antibody (B01P)