COX15 polyclonal antibody (A01)
  • COX15 polyclonal antibody (A01)

COX15 polyclonal antibody (A01)

Ref: AB-H00001355-A01
COX15 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COX15.
Información adicional
Size 50 uL
Gene Name COX15
Gene Alias -
Gene Description COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 1355

Enviar un mensaje


COX15 polyclonal antibody (A01)

COX15 polyclonal antibody (A01)