COX11 purified MaxPab mouse polyclonal antibody (B02P)
  • COX11 purified MaxPab mouse polyclonal antibody (B02P)

COX11 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00001353-B02P
COX11 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human COX11 protein.
Información adicional
Size 50 ug
Gene Name COX11
Gene Alias COX11P
Gene Description COX11 homolog, cytochrome c oxidase assembly protein (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRWQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COX11 (AAH05895, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1353

Enviar un mensaje


COX11 purified MaxPab mouse polyclonal antibody (B02P)

COX11 purified MaxPab mouse polyclonal antibody (B02P)