COX10 purified MaxPab rabbit polyclonal antibody (D01P)
  • COX10 purified MaxPab rabbit polyclonal antibody (D01P)

COX10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00001352-D01P
COX10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COX10 protein.
Información adicional
Size 100 ug
Gene Name COX10
Gene Alias -
Gene Description COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMYVTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILAQLSKIKLTALVVSTTAAGFALAPGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COX10 (AAH00060.1, 1 a.a. ~ 443 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 1352

Enviar un mensaje


COX10 purified MaxPab rabbit polyclonal antibody (D01P)

COX10 purified MaxPab rabbit polyclonal antibody (D01P)